ZBTB20 Rabbit Polyclonal Antibody

CAT#: TA329421

Rabbit Polyclonal anti-ZBTB20 antibody

Product Images

WB Suggested Anti-ZBTB20 Antibody Titration: 2.0 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBTB20 antibody: synthetic peptide directed towards the middle region of human ZBTB20. Synthetic peptide located within the following region: SNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: zinc finger and BTB domain containing 20
• Database Link:
  NP_056457
  Entrez Gene 26137 Human
  UniProt ID Q9HC78
• Background: ZBTB20 is a 733-residue protein with a BTB/POZ domain at the N-terminal and 4 C2H2 zinc fingers at C-terminal. It is localized on chromosome 3. It is widely expressed in hematopoietic tissues
• Synonyms: DPZF; HOF; ODA-8S; PRIMS; ZNF288
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors