GPR87 Rabbit Polyclonal Antibody

CAT#: TA329469

Rabbit Polyclonal anti-GPR87 antibody

Specifications

Product Data

• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR87 antibody: synthetic peptide directed towards the middle region of human GPR87. Synthetic peptide located within the following region: NQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: G protein-coupled receptor 87
• Database Link:
  NP_076404
  Entrez Gene 53836 Human
  UniProt ID Q9BY21
• Background: G protein-coupled receptors play a role in cell communication. They are characterized by an extracellular N terminus, 7 transmembrane regions, and an intracellular C terminus.
• Synonyms: FKSG78; GPR95; KPG_002
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Rat: 79%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane