RGS18 Rabbit Polyclonal Antibody

CAT#: TA329536

Rabbit Polyclonal anti-RGS18 antibody

Product Images

WB Suggested Anti-RGS18 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RGS18 antibody: synthetic peptide directed towards the middle region of human RGS18. Synthetic peptide located within the following region: EDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: regulator of G-protein signaling 18
• Database Link:
  NP_570138
  Entrez Gene 64407 Human
  UniProt ID Q9NS28
• Background: RGS18 is a member of the regulator of G-protein signaling family. This protein is contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signaling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal.
• Synonyms: RGS13
• Note: Immunogen sequence homology: Human: 100%; Rat: 86%; Horse: 86%; Pig: 79%; Guinea pig: 79%