Germany
Japan
United Kingdom
China
Goat Anti-RGS18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CNEFQDVQSDVAIWL, from the C Terminus of the protein sequence according to NP_570138.1. |
Antibodies
View as table Download
Rabbit Polyclonal anti-RGS18 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RGS18 antibody: synthetic peptide directed towards the middle region of human RGS18. Synthetic peptide located within the following region: EDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPT |
Rabbit Polyclonal anti-Rgs18 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rgs18 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AKEKRNRLSLLLQRPDFHGETQASRSALLAKETRVSPEEAVKWAESFDKL |
Rabbit Polyclonal RGS18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 200-218 of human RGS18 (Genebank accession no NP_570138). were used as immunogen. |
Rabbit Polyclonal RGS18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Within the range of amino acids 30-62 of human RGS18 protein were used as the immunogen. |
Carrier-free (BSA/glycerol-free) RGS18 mouse monoclonal antibody,clone OTI8C8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RGS18 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RGS18 |
RGS18 mouse monoclonal antibody,clone OTI8C8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RGS18 mouse monoclonal antibody,clone OTI8C8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
RGS18 mouse monoclonal antibody,clone OTI8C8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
RGS18 mouse monoclonal antibody,clone OTI8C8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RGS18