MKRN3 Rabbit Polyclonal Antibody

CAT#: TA329564

Rabbit Polyclonal anti-Mkrn3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MKRN3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Mkrn3 antibody is: synthetic peptide directed towards the middle region of Rat Mkrn3. Synthetic peptide located within the following region: ARGGQDSQPRASADRGPKMATHWEPPTQEVAEAPPTASSSSLPLIGSAAE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 57 kDa
Gene Name makorin ring finger protein 3
Background The function of this protein remains unknown.
Synonyms CPPB2; D15S9; RNF63; ZFP127; ZNF127
Note Immunogen sequence homology: Human: 100%; Mouse: 100%; Rat: 93%; Rabbit: 93%; Pig: 92%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.