TEA domain family member 2 (TEAD2) Rabbit Polyclonal Antibody

CAT#: TA329656

Rabbit Polyclonal anti-TEAD2 antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TEAD2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TEAD2 antibody: synthetic peptide directed towards the middle region of human TEAD2. Synthetic peptide located within the following region: SGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 49 kDa
Gene Name TEA domain transcription factor 2
Background TEAD2 is a putative transcription factor that binds to the SPH and GT-IIC enhansons (5'-GTGGAATGT-3'). TEAD2 may be involved in the gene regulation of neural development. TEAD2 binds to the M-CAT motif.
Synonyms ETF; TEAD-2; TEF-4; TEF4
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 86%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.