FOXN1 Rabbit Polyclonal Antibody

CAT#: TA329658

Rabbit Polyclonal anti-FOXN1 antibody

Product Images

WB Suggested Anti-FOXN1 Antibody Titration: 5.0ug/ml; ELISA Titer: 1:1562500; Positive Control: Raji cell lysateFOXN1 is supported by BioGPS gene expression data to be expressed in Raji

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXN1 antibody: synthetic peptide directed towards the N terminal of human FOXN1. Synthetic peptide located within the following region: FVSDGPPERTPSLPPHSPRIASPGPEQVQGHCPAGPGPGPFRLSPSDKYP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: forkhead box N1
• Database Link:
  NP_003584
  Entrez Gene 8456 Human
  UniProt ID O15353
• Background: Mutations in the winged-helix transcription factor gene at the nude locus in mice and rats produce the pleiotropic phenotype of hairlessness and athymia, resulting in a severely compromised immune system. This gene is orthologous to the mouse and rat genes and encodes a similar DNA-binding transcription factor that is thought to regulate keratin gene expression. A mutation in this gene has been correlated with T-cell immunodeficiency, the skin disorder congenital alopecia, and nail dystrophy. Alternative splicing in the 5' UTR of this gene has been observed.
• Synonyms: FKHL20; RONU; WHN
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 86%; Guinea pig: 86%; Dog: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors