Antibodies

View as table Download

Rabbit polyclonal antibody to FOXN1 (forkhead box N1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 585 and 648 of FOXN1 (Uniprot ID#O15353)

FOXN1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated corresponding to Human Forkhead box N1.

FOXN1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 357-386 amino acids from the Central region of human FOXN1

Goat Polyclonal Antibody against FOXN1

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SVYLSPSSKPVALA, from the C Terminus of the protein sequence according to NP_003584.

Rabbit Polyclonal anti-FOXN1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXN1 antibody: synthetic peptide directed towards the N terminal of human FOXN1. Synthetic peptide located within the following region: FVSDGPPERTPSLPPHSPRIASPGPEQVQGHCPAGPGPGPFRLSPSDKYP

Anti-FOXN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 586-600 amino acids of Human forkhead box N1

Anti-FOXN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 586-600 amino acids of Human forkhead box N1