TBX21 Rabbit Polyclonal Antibody

CAT#: TA329696

Rabbit Polyclonal Anti-TBX21 Antibody

Product Images

WB Suggested Anti-TBX21 Antibody Titration: 2.5ug/ml; ELISA Titer: 1:62500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the N terminal of human TBX21. Synthetic peptide located within the following region: FYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSRFLGAYAYPPRPQAAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: T-box 21
• Database Link:
  NP_037483
  Entrez Gene 30009 Human
  UniProt ID Q9UL17
• Background: This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells. [provided by RefSeq, Jul 2008]
• Synonyms: T-bet; T-PET; TBET; TBLYM
• Note: Immunogen sequence homology: Human: 100%; Dog: 85%; Pig: 85%; Mouse: 77%; Bovine: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors