HSPC150 (UBE2T) Rabbit Polyclonal Antibody

CAT#: TA329837

Rabbit Polyclonal Anti-UBE2T Antibody

Product Images

WB Suggested Anti-UBE2T Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UBE2T antibody: synthetic peptide directed towards the N terminal of human UBE2T. Synthetic peptide located within the following region: MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: ubiquitin conjugating enzyme E2 T
• Database Link:
  NP_054895
  Entrez Gene 29089 Human
  UniProt ID Q9NPD8
• Background: The covalent conjugation of ubiquitin to proteins regulates diverse cellular pathways and proteins. Ubiquitin is transferred to a target protein through a concerted action of a ubiquitin-activating enzyme (E1), a ubiquitin-conjugating enzyme (E2), such as UBE2T, and a ubiquitin ligase (E3) (Machida et al., 2006 [PubMed 16916645]).
• Synonyms: FANCT; HSPC150; PIG50
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 92%; Dog: 86%; Horse: 86%

Reference Data

• Protein Families: Druggable Genome