C14orf130 (UBR7) Rabbit Polyclonal Antibody

CAT#: TA329874

Rabbit Polyclonal Anti-UBR7 Antibody

Product Images

WB Suggested Anti-C14orf130 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysateUBR7 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C14orf130 antibody: synthetic peptide directed towards the middle region of human C14orf130. Synthetic peptide located within the following region: MIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: ubiquitin protein ligase E3 component n-recognin 7 (putative)
• Database Link:
  NP_786924
  Entrez Gene 55148 Human
  UniProt ID Q8N806
• Background: The function remains unknown.
• Synonyms: C14orf130
• Note: Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome