MYF5 Rabbit Polyclonal Antibody

CAT#: TA329909

Rabbit Polyclonal Anti-MYF5 Antibody

Product Images

Lanes: 1: Mouse skeletal muscle lysate, 2: Mouse skeletal muscle lysate; Primary Antibody Dilution:1:1000; Secondary Antibody:Anti-rabbit HRP; Secondary Antibody Dilution:1:10000; Gene Name:MYF5; Submitted by:Anonymous;

• 

  WB Suggested Anti-MYF5 Antibody; Titration: 1 ug/ml; Positive Control: Human Jurkat Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYF5 antibody: synthetic peptide directed towards the N terminal of human MYF5. Synthetic peptide located within the following region: ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: myogenic factor 5
• Database Link:
  NP_005584
  Entrez Gene 17877 MouseEntrez Gene 4617 Human
  UniProt ID P13349
• Background: MYF5 is a member of the myogenic basic helix-loop-helix family of transcription factors, which can activate the muscle differentiation program.
• Synonyms: bHLHc2
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors