RNF12 (RLIM) Rabbit Polyclonal Antibody

CAT#: TA329917

Rabbit Polyclonal Anti-RNF12 Antibody

Product Images

WB Suggested Anti-RNF12 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateRLIM is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human Spermatophore

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNF12 antibody: synthetic peptide directed towards the C terminal of human RNF12. Synthetic peptide located within the following region: AQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: ring finger protein, LIM domain interacting
• Database Link:
  NP_057204
  Entrez Gene 51132 Human
  UniProt ID Q9NVW2
• Background: RNF12 is a RING-H2 zinc finger protein. It has been shown to be a ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Alternatively spliced transcript variants encoding the same protein have been reported.
• Synonyms: NY-REN-43; RNF12
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93%; Yeast: 89%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors