Sp7 Rabbit Polyclonal Antibody

CAT#: TA329974

Rabbit Polyclonal Anti-Sp7 Antibody

Product Images

Host: Rabbit; Target Name: Sp7; Sample Tissue: Rat Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Sp7 antibody is: synthetic peptide directed towards the N-terminal region of Rat Sp7. Synthetic peptide located within the following region: MLTAACSKFGGSSPLRDSTALGKGGTKKPYTDLSAPKTMGDAYPAPFSST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: Sp7 transcription factor
• Database Link:
  NP_001032721
  Entrez Gene 300260 Rat
• Background: Q6IMK1 may act as a transcription factor; mouse homolog is required for bone formation and osteoblast differentiation.
• Synonyms: MGC126598; osterix; OSX
• Note: Immunogen sequence homology: Mouse: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Dog: 86%; Rabbit: 86%; Guinea pig: 86%