HOX11 (TLX1) Rabbit Polyclonal Antibody

CAT#: TA330029

Rabbit Polyclonal Anti-TLX1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TLX1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TLX1 antibody: synthetic peptide directed towards the middle region of human TLX1. Synthetic peptide located within the following region: VAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTGHPY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 34 kDa
Gene Name T-cell leukemia homeobox 1
Background TLX1 contains 1 homeobox DNA-binding domain. TLX1 controls the genesis of the spleen. A chromosomal aberration involving TLX1, translocation t(10;14)(q24;q11) with TCRD, may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL).
Synonyms HOX11; TCL3
Note Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.