Germany
Japan
United Kingdom
China
Antibodies
View as table Download
HOX11 (TLX1) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 162-191 amino acids from the Central region of human TLX1 |
Rabbit Polyclonal Anti-TLX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLX1 antibody: synthetic peptide directed towards the middle region of human TLX1. Synthetic peptide located within the following region: VAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTGHPY |
Rabbit Polyclonal Anti-TLX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLX1 antibody: synthetic peptide directed towards the middle region of human TLX1. Synthetic peptide located within the following region: EAFQKSLAQPLPADPLCVHNSSLFALQNLQPWSDDSTKITSVTSVASACE |
Rabbit Polyclonal Anti-TLX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLX1 antibody: synthetic peptide directed towards the N terminal of human TLX1. Synthetic peptide located within the following region: MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCL |
TLX1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TLX1 |
TLX1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human TLX1 (NP_001182446.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TLX1