HOX11 (TLX1) Rabbit Polyclonal Antibody

CAT#: TA330030

Rabbit Polyclonal Anti-TLX1 Antibody

Product Images

WB Suggested Anti-TLX1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TLX1 antibody: synthetic peptide directed towards the middle region of human TLX1. Synthetic peptide located within the following region: EAFQKSLAQPLPADPLCVHNSSLFALQNLQPWSDDSTKITSVTSVASACE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: T-cell leukemia homeobox 1
• Database Link:
  NP_005512
  Entrez Gene 3195 Human
  UniProt ID P31314
• Background: TLX1 contains 1 homeobox DNA-binding domain. TLX1 controls the genesis of the spleen. A chromosomal aberration involving TLX1, translocation t(10;14)(q24;q11) with TCRD, may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL).
• Synonyms: HOX11; TCL3
• Note: Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; African clawed frog: 85%