IRF2 Rabbit Polyclonal Antibody

CAT#: TA330031

Rabbit Polyclonal Anti-IRF2 Antibody

Product Images

WB Suggested Anti-IRF2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IRF2 antibody: synthetic peptide directed towards the N terminal of human IRF2. Synthetic peptide located within the following region: APLFRNRAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: interferon regulatory factor 2
• Database Link:
  NP_002190
  Entrez Gene 3660 Human
  UniProt ID P14316
• Background: IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4.
• Synonyms: IRF-2
• Note: Immunogen sequence homology: Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rat: 100%; Bovine: 92%; Mouse: 92%; Sheep: 92%; Zebrafish: 90%; African clawed frog: 85%; Chicken: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors