NFIC Rabbit Polyclonal Antibody

CAT#: TA330059

Rabbit Polyclonal Anti-NFIC Antibody

Product Images

WB Suggested Anti-NFIC Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 721_B cell lysateNFIC is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NFIC antibody: synthetic peptide directed towards the middle region of human NFIC. Synthetic peptide located within the following region: MLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPDTSPANRSFVG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: nuclear factor I C
• Database Link:
  NP_995315
  Entrez Gene 4782 Human
  UniProt ID P08651
• Background: Brg- or hBrm-associated factor (BAF) complexes, a chromatin-remodeling complex family of mammalian cells, facilitate transcriptional activity by remodeling nucleosome structure. Brg1 is the core subunit of Brg-associated factor complexes. BAF complexes can interact with NF1/CTF and RNAP II, and this interaction is closely dependent on the activation of gene transcription.
• Synonyms: CTF; CTF5; NF-I; NFI
• Note: Immunogen sequence homology: Human: 100%; Dog: 85%; Pig: 85%

Reference Data

• Protein Families: Transcription Factors