Rel B (RELB) Rabbit Polyclonal Antibody

CAT#: TA330069

Rabbit Polyclonal Anti-RELB Antibody

Product Images

WB Suggested Anti-RELB Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:7812500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RELB antibody: synthetic peptide directed towards the middle region of human RELB. Synthetic peptide located within the following region: FTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: RELB proto-oncogene, NF-kB subunit
• Database Link:
  NP_006500
  Entrez Gene 5971 Human
  UniProt ID Q01201
• Background: RELB neither associates with DNA nor with RELA/p65 or REL. It stimulates promoter activity in the presence of NFKB2/p49.
• Synonyms: I-REL; IREL; REL-B
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 92%; Dog: 85%; Horse: 85%; Mouse: 85%; Bovine: 78%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: MAPK signaling pathway