AP2 alpha (TFAP2A) Rabbit Polyclonal Antibody

CAT#: TA330109

Rabbit Polyclonal Anti-TFAP2A Antibody

Product Images

WB Suggested Anti-TFAP2A Antibody Titration: 1.25ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TFAP2A antibody: synthetic peptide directed towards the C terminal of human TFAP2A. Synthetic peptide located within the following region: NLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: transcription factor AP-2 alpha
• Database Link:
  NP_003211
  Entrez Gene 21418 MouseEntrez Gene 7020 Human
  UniProt ID P05549
• Background: TFAP2A is a sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limbs and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2 alpha is the only AP-2 protein required for early morphogenesis of the lens vesicleAP2-alpha is a 52-kD retinoic acid-inducible and developmentally regulated activator of transcription that binds to a consensus DNA-binding sequence CCCCAGGC in the SV40 and metallothionein (MIM 156350) promoters. [supplied by OMIM]
• Synonyms: AP-2; AP-2alpha; AP2TF; BOFS; TFAP2
• Note: Immunogen sequence homology: Human: 100%; Dog: 92%; Guinea pig: 92%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Chicken: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors