PARIS (ZNF746) Rabbit Polyclonal Antibody

CAT#: TA330192

Rabbit Polyclonal Anti-ZNF746 Antibody

Product Images

WB Suggested Anti-ZNF746 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HT1080 cell lysate

• 

  IHC Suggested Anti-ZNF746 antibody; Titration: 5ug/ ml; Positive Control: Spleen

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF746 antibody: synthetic peptide directed towards the middle region of human ZNF746. Synthetic peptide located within the following region: TGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: zinc finger protein 746
• Database Link:
  NP_689770
  Entrez Gene 155061 Human
  UniProt ID Q6NUN9
• Background: ZNF746 may be involved in transcriptional regulation.
• Synonyms: PARIS
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%