Esrra Rabbit Polyclonal Antibody

CAT#: TA330219

Rabbit Polyclonal Anti-Esrra Antibody

Product Images

WB Suggested Anti-Esrra Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Esrra antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: estrogen related receptor, alpha
• Database Link:
  NP_031979
  Entrez Gene 26379 Mouse
  UniProt ID O08580
• Background: Esrra binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. It can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. It binds to the C1 region of the lactoferrin gene promoter. It requires dimerization and the coactivator, PGC-1A, for full activity. The ERRalpha/PGC1alpha complex is a regulator of energy metabolism.
• Synonyms: ERR-alpha; ERR1; ERRa; ERRalpha; ESRL1; NR3B1; OTTHUMP00000198091
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%