Pea3 (ETV4) Rabbit Polyclonal Antibody

CAT#: TA330223

Rabbit Polyclonal Anti-ETV4 Antibody

Product Images

WB Suggested Anti-ETV4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ETV4 antibody: synthetic peptide directed towards the middle region of human ETV4. Synthetic peptide located within the following region: HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: ETS variant 4
• Database Link:
  NP_001977
  Entrez Gene 2118 Human
  UniProt ID P43268
• Background: The protein encoded by the ETV4 gene is known to play a role in ovarian and breast malignancies as well as in the early stage of colorectal carcinogenesis.
• Synonyms: E1A-F; E1AF; PEA3; PEAS3
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Rabbit: 93%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors