ID4 Rabbit Polyclonal Antibody

CAT#: TA330251

Rabbit Polyclonal Anti-ID4 Antibody

Product Images

Lanes : Lane 1: 10ug MDA-MB231 lysateLane 2: 10ug MCF7 lysate; Primary Antibody Dilution : 1:1000; Secondary Antibody : Anti-rabbit-HRP; Secondary Antibody Dilution : 1:10,000; Gene Name : ID4; Submitted by : Maria Teresita Branham. Facultad de Cs Mè??dic

• 

  WB Suggested Anti-ID4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 293T cell lysateID4 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ID4 antibody: synthetic peptide directed towards the middle region of human ID4. Synthetic peptide located within the following region: CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: inhibitor of DNA binding 4, HLH protein
• Database Link:
  NP_001537
  Entrez Gene 3400 Human
  UniProt ID P47928
• Background: Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins.Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al., 1995 [PubMed 7665172]). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: bHLHb27; IDB4
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Zebrafish: 86%; Bovine: 85%; Guinea pig: 85%; Rabbit: 79%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: TGF-beta signaling pathway