Tpit (TBX19) Rabbit Polyclonal Antibody

CAT#: TA330268

Rabbit Polyclonal Anti-TBX19 Antibody

Product Images

WB Suggested Anti-TBX19 Antibody Titration: 1.0-1.5ug/ml; Positive Control: Jurkat cell lysate

• 

  Paraffin Embedded Tissue: Human Liver; Cellular with positive label: Hepatocyte (indicated with Arrows); Antibody Concentration: 4~8 ug/ml; Magnification: 400X

• 

  Paraffin Embeded Tissue: Human Kidney; Cells with positive label: Epithelial cells of renal tubule (indicated with Arrows); Antibody Concentration: 4~8 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBX19 antibody: synthetic peptide directed towards the N terminal of human TBX19. Synthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: T-box 19
• Database Link:
  NP_005140
  Entrez Gene 9095 Human
  UniProt ID O60806
• Background: TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX19 is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage.
• Synonyms: dJ747L4.1; TBS19; TPIT
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%