CDK4 Rabbit Polyclonal Antibody

CAT#: TA330308

Rabbit Polyclonal Anti-CDK4 Antibody

Product Images

WB Suggested Anti-CDK4 Antibody Titration: 1.0ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDK4 antibody: synthetic peptide directed towards the C terminal of human CDK4. Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: cyclin-dependent kinase 4
• Database Link:
  NP_000066
  Entrez Gene 1019 Human
  UniProt ID P11802
• Background: Cdk4 is probably involved in the control of the cell cycle.
• Synonyms: CMM3; PSK-J3
• Note: Immunogen sequence homology: Human: 100%; Pig: 92%; Dog: 85%; Rabbit: 85%; Bovine: 78%; Rat: 78%; Sheep: 78%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Bladder cancer, Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer, T cell receptor signaling pathway, Tight junction