Hsp47 (SERPINH1) Rabbit Polyclonal Antibody

CAT#: TA330391

Rabbit Polyclonal Anti-SERPINH1 Antibody

Product Images

WB Suggested Anti-SERPINH1 Antibody ; Positive Control: Lane 1: 80 ug mouse brain extract; Primary Antibody Dilution : 1:500; Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR Bioscience; Secondry Antibody Dilution : 1:20,000; Submitted by: D

• 

  WB Suggested Anti-SERPINH1 Antibody; Titration: 1.25 ug/ml; Positive Control: Placenta cell lysate

• 

  Amount and Sample Type : 500 ug mouse brain homogenate; Amount of IP Antibody : 6 ug; Primary Antibody : SERPINH1; Primary Antibody Dilution : 1:500; Secondary Antibody : Goat anti-rabbit Alexa-Fluor 594; Secondary Antibody Dilution : 1:5000; Gene Name :

Specifications

Product Data

• Applications: IP, WB
• Recommended Dilution: WB, IP
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SERPINH1 antibody: synthetic peptide directed towards the C terminal of human SERPINH1. Synthetic peptide located within the following region: DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRLKGDKMRDEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: serpin family H member 1
• Database Link:
  NP_001226
  Entrez Gene 12406 MouseEntrez Gene 871 Human
  UniProt ID P50454
• Background: Serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)
• Synonyms: AsTP3; CBP1; CBP2; gp46; HSP47; OI10; PIG14; PPROM; RA-A47; SERPINH2
• Note: Immunogen sequence homology: Dog: 91%; Horse: 91%; Human: 91%; Mouse: 91%; Pig: 91%; Rat: 91%

Reference Data

• Protein Families: Druggable Genome