PCGF6 Rabbit Polyclonal Antibody

CAT#: TA330481

Rabbit Polyclonal Anti-PCGF6 Antibody

Product Images

WB Suggested Anti-PCGF6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PCGF6 antibody: synthetic peptide directed towards the middle region of human PCGF6. Synthetic peptide located within the following region: TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: polycomb group ring finger 6
• Database Link:
  NP_115530
  Entrez Gene 84108 Human
  UniProt ID Q9BYE7
• Background: The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1. PcG proteins are known to form protein complexes and function as transcription repressors. This protein has been shown to interact with some PcG proteins and act as a transcription repressor. The activity of this protein is found to be regulated by cell cycle dependent phosphorylation. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: MBLR; RNF134
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors