PCGF5 Rabbit Polyclonal Antibody

CAT#: TA330483

Rabbit Polyclonal Anti-PCGF5 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PCGF5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PCGF5 antibody: synthetic peptide directed towards the N terminal of human PCGF5. Synthetic peptide located within the following region: ATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 30 kDa
Gene Name polycomb group ring finger 5
Background PCGF5 contains 1 RING-type zinc finger. It is probable component of some Polycomb group (PcG) multiprotein complex, a complex required to maintain the transcriptionally repressive state of some genes.
Synonyms RNF159
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Zebrafish: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.