PATZ1 Rabbit Polyclonal Antibody

CAT#: TA330579

Rabbit Polyclonal Anti-PATZ1 Antibody

Product Images

WB Suggested Anti-PATZ1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: OVCAR-3 cell lysate

• 

  Host: Rabbit; Target Name: PATZ1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: PATZ1; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: PATZ1; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PATZ1 antibody: synthetic peptide directed towards the N terminal of human PATZ1. Synthetic peptide located within the following region: KNGGRFCDVLLRVGDESFPAHRAVLAACSEYFESVFSAQLGDGGAADGGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: POZ/BTB and AT hook containing zinc finger 1
• Database Link:
  NP_055138
  Entrez Gene 23598 Human
  UniProt ID Q9HBE1
• Background: PATZ1 contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction
• Synonyms: dJ400N23; MAZR; PATZ; RIAZ; ZBTB19; ZNF278; ZSG
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors