MLLT1 Rabbit Polyclonal Antibody

CAT#: TA331116

Rabbit Polyclonal Anti-MLLT1 Antibody

Product Images

WB Suggested Anti-MLLT1 Antibody Titration: 1.4ug/ml; Positive Control: Raji cell lysateMLLT1 is supported by BioGPS gene expression data to be expressed in Raji

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MLLT1 antibody: synthetic peptide directed towards the middle region of human MLLT1. Synthetic peptide located within the following region: EESNSEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQGPLRSMV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: myeloid/lymphoid or mixed-lineage leukemia; translocated to, 1
• Database Link:
  NP_005925
  Entrez Gene 4298 Human
  UniProt ID Q03111
• Background: MLLT1 is a homolog of the yeast SWI/SNF subunit, ANC1/TFG3. Moreover, MLLT0 is a fusion partner for the gene product of MLL that is a common target for chromosomal translocations in human acute leukemia
• Synonyms: ENL; LTG19; YEATS1
• Note: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors