PAR4 (PAWR) Rabbit Polyclonal Antibody

CAT#: TA331131

Rabbit Polyclonal Anti-PAWR Antibody

Product Images

WB Suggested Anti-PAWR Antibody Titration: 0.5-1.0ug/ml; Positive Control: Jurkat cell lysate

• 

  Human Liver

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PAWR antibody: synthetic peptide directed towards the middle region of human PAWR. Synthetic peptide located within the following region: SYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: pro-apoptotic WT1 regulator
• Database Link:
  NP_002574
  Entrez Gene 5074 Human
  UniProt ID Q96IZ0
• Background: The tumor suppressor WT1 represses and activates transcription. Anti-Prostate Apoptosis Response Protein Par-4 (PAWR) is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells.
• Synonyms: Par-4; PAR4
• Note: Dog: 100%; Human: 100%; Rat: 91%; Mouse: 91%; Horse: 85%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors