RRAGB Rabbit Polyclonal Antibody

CAT#: TA331223

Rabbit Polyclonal Anti-RRAGB Antibody

Product Images

Host: Rabbit; Target Name: RRAGB; Sample Tissue: PANC1 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RRAGB antibody is: synthetic peptide directed towards the C-terminal region of Human RRAGB. Synthetic peptide located within the following region: IDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: Ras related GTP binding B
• Database Link:
  NP_057740
  Entrez Gene 10325 Human
  UniProt ID Q5VZM2
• Background: Ras-homologous GTPases constitute a large family of signal transducers that alternate between an activated, GTP-binding state and an inactivated, GDP-binding state. These proteins represent cellular switches that are operated by GTP-exchange factors and factors that stimulate their intrinsic GTPase activity. All GTPases of the Ras superfamily have in common the presence of six conserved motifs involved in GTP/GDP binding, three of which are phosphate-/magnesium-binding sites (PM1-PM3) and three of which are guanine nucleotide-binding sites (G1-G3). Transcript variants encoding distinct isoforms have been identified.
• Synonyms: bA465E19.1; RAGB
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%