Eif2b3 Rabbit Polyclonal Antibody

CAT#: TA331249

Rabbit Polyclonal Anti-Eif2b3 Antibody

Product Images

Host: Rabbit; Target Name: Eif2b3; Sample Tissue: Rat Brain lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Eif2b3 antibody is: synthetic peptide directed towards the middle region of Rat Eif2b3. Synthetic peptide located within the following region: FRAYDASLAMLMRKGQESTEPVPGQKGKKKTVEQRDFIGVDSTGKRLLFM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: eukaryotic translation initiation factor 2B, subunit 3 gamma
• Database Link:
  NP_598293
  Entrez Gene 171145 Rat
  UniProt ID P70541
• Background: Eif2b3 is a guanine nucleotide exchange factor that regulates key step in protein synthesis; restores eIF2 to its active GTP-bound state.
• Synonyms: EIF-2B; EIF2Bgamma
• Note: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93%