Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-EIF2B3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human EIF2B3. |
Antibodies
View as table Download
EIF2B3 (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of Human EIF2B3. |
Rabbit Polyclonal Anti-EIF2B3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EIF2B3 antibody is: synthetic peptide directed towards the middle region of Human EIF2B3. Synthetic peptide located within the following region: ENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSF |
Rabbit Polyclonal Anti-Eif2b3 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Eif2b3 antibody is: synthetic peptide directed towards the middle region of Rat Eif2b3. Synthetic peptide located within the following region: FRAYDASLAMLMRKGQESTEPVPGQKGKKKTVEQRDFIGVDSTGKRLLFM |
EIF2B3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EIF2B3 |
EIF2B3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human EIF2B3 (NP_065098.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- EIF2B3