GPLD1 Rabbit Polyclonal Antibody

CAT#: TA331258

Rabbit Polyclonal Anti-GPLD1 Antibody

Product Images

WB Suggested Anti-GPLD1 Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole CellGPLD1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GPLD1 antibody is: synthetic peptide directed towards the N-terminal region of Human GPLD1. Synthetic peptide located within the following region: GKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: glycosylphosphatidylinositol specific phospholipase D1
• Database Link:
  NP_001494
  Entrez Gene 2822 Human
  UniProt ID P80108
• Background: Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane.
• Synonyms: GPIPLD; GPIPLDM; PIGPLD; PIGPLD1; PLD
• Note: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Guinea pig: 86%; Bovine: 85%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Glycosylphosphatidylinositol(GPI)-anchor biosynthesis