GPLD1 Rabbit Polyclonal Antibody
Other products for "GPLD1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-GPLD1 antibody is: synthetic peptide directed towards the N-terminal region of Human GPLD1. Synthetic peptide located within the following region: GKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMA |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 90 kDa |
| Gene Name | glycosylphosphatidylinositol specific phospholipase D1 |
| Database Link | |
| Background | Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane. |
| Synonyms | GPIPLD; GPIPLDM; PIGPLD; PIGPLD1; PLD |
| Note | Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Guinea pig: 86%; Bovine: 85% |
| Reference Data | |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China