DUS4L Rabbit Polyclonal Antibody

CAT#: TA331552

Rabbit Polyclonal Anti-DUS4L Antibody

Product Images

Host: Rabbit; Target Name: DUS4L; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DUS4L Antibody is: synthetic peptide directed towards the N-terminal region of Human DUS4L. Synthetic peptide located within the following region: SKLAFRTLVRKYSCDLCYTPMIVAADFVKSIKARDSEFTTNQGDCPLIVQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: dihydrouridine synthase 4 like
• Database Link:
  NP_853559
  Entrez Gene 11062 Human
  UniProt ID O95620
• Background: DUS4L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.
• Synonyms: DUS4; PP35
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%