C14orf130 (UBR7) Rabbit Polyclonal Antibody

CAT#: TA331577

Rabbit Polyclonal Anti-Ubr7 Antibody

Product Images

Host: Rabbit; Target Name: Ubr7; Sample Tissue: Rat Liver lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ubr7 Antibody is: synthetic peptide directed towards the N-terminal region of RAT Ubr7. Synthetic peptide located within the following region: HGSHKLFELYTKRNFRCDCGNSKFKNLECKLFPDKSKVNSCNKYNDNFFG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: ubiquitin protein ligase E3 component n-recognin 7 (putative)
• Database Link:
  NP_786924
  Entrez Gene 314399 Rat
  UniProt ID Q8N806
• Background: The function of this protein remains unknown.
• Synonyms: C14orf130
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome