SLITRK4 Rabbit Polyclonal Antibody

CAT#: TA331600

Rabbit Polyclonal Anti-SLITRK4 Antibody

Product Images

Host: Rabbit; Target Name: SLITRK4; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLITRK4 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLITRK4. Synthetic peptide located within the following region: CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 92 kDa
• Gene Name: SLIT and NTRK like family member 4
• Database Link:
  NP_775101
  Entrez Gene 139065 Human
  UniProt ID Q8IW52
• Background: This gene encodes a transmembrane protein belonging to the the SLITRK family. These family members include two N-terminal leucine-rich repeat domains similar to those found in the axonal growth-controlling protein SLIT, as well as C-terminal regions similar to neurotrophin receptors. Studies of an homologous protein in mouse suggest that this family member functions to suppress neurite outgrowth.
• Synonyms: DKFZp547M2010
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 93%; Pig: 79%

Reference Data

• Protein Families: Transmembrane