ZNF350 Rabbit Polyclonal Antibody

CAT#: TA331787

Rabbit Polyclonal Anti-ZNF350 Antibody

Product Images

WB Suggested Anti-ZNF350 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF350 Antibody: synthetic peptide directed towards the N terminal of human ZNF350. Synthetic peptide located within the following region: AFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: zinc finger protein 350
• Database Link:
  NP_067645
  Entrez Gene 59348 Human
  UniProt ID Q9GZX5
• Background: ZNF350 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 8 C2H2-type zinc fingers and 1 KRAB domain. ZNF350 is a transcriptional repressor. It binds to a specific sequence, 5'-GGGxxxCAGxxxTTT-3', within GADD45 intron 3.
• Synonyms: ZBRK1; ZFQR
• Note: Immunogen sequence homology: Human: 100%; Horse: 86%; Dog: 85%

Reference Data

• Protein Families: Transcription Factors