ZBTB4 Rabbit Polyclonal Antibody

CAT#: TA331809

Rabbit Polyclonal Anti-ZBTB4 Antibody

Product Images

WB Suggested Anti-ZBTB4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZBTB4 Antibody: synthetic peptide directed towards the middle region of human ZBTB4. Synthetic peptide located within the following region: RPGGTPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 105 kDa
• Gene Name: zinc finger and BTB domain containing 4
• Database Link:
  NP_065950
  Entrez Gene 57659 Human
  UniProt ID Q9P1Z0
• Background: ZBTB4 may be involved in transcriptional regulation.
• Synonyms: KAISO-L1; ZNF903
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%; Rabbit: 86%