Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ZBTB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB4 antibody: synthetic peptide directed towards the C terminal of human ZBTB4. Synthetic peptide located within the following region: PFLPGVFGYAVNPQAAPPAPPTPPPPTLPPPIPPKGEGERAGVERTQKGD |
Rabbit Polyclonal Anti-ZBTB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZBTB4 Antibody: synthetic peptide directed towards the middle region of human ZBTB4. Synthetic peptide located within the following region: RPGGTPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEE |
Rabbit anti ZBTB4-NT Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of human ZBTB4 protein. This sequence is identical to human, mouse, rat, bovine, canis etc. |
Rabbit anti ZBTB4-CT Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human ZBTB4 protein. This sequence is identical to human, mouse, rat, etc. |
USD 420.00
4 Weeks
Active filters
Target Symbol
- ZBTB4