LXR beta (NR1H2) Rabbit Polyclonal Antibody
Other products for "NR1H2"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Rat |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-Nr1h2 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Nr1h2. Synthetic peptide located within the following region: ASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQL |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 48 kDa |
| Gene Name | nuclear receptor subfamily 1 group H member 2 |
| Database Link | |
| Background | Nr1h2 is a nuclear orphan receptor; It may be involved in modulating 9-cis-retinoic acid signaling by interacting with retinoic acid receptor (RXR). |
| Synonyms | LXR-b; LXRB; NER; NER-I; RIP15; UNR |
| Note | Immunogen sequence homology: Rat: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Guinea pig: 86% |
| Reference Data | |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China