LXR beta (NR1H2) Rabbit Polyclonal Antibody

CAT#: TA332017

Rabbit Polyclonal Anti-Nr1h2 Antibody

Product Images

Host: Rabbit; Target Name: Nr1h2; Sample Tissue: Rat Thymus lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Nr1h2 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Nr1h2. Synthetic peptide located within the following region: ASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: nuclear receptor subfamily 1 group H member 2
• Database Link:
  NP_009052
  Entrez Gene 58851 Rat
  UniProt ID P55055
• Background: Nr1h2 is a nuclear orphan receptor; It may be involved in modulating 9-cis-retinoic acid signaling by interacting with retinoic acid receptor (RXR).
• Synonyms: LXR-b; LXRB; NER; NER-I; RIP15; UNR
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors