Rel B (RELB) Rabbit Polyclonal Antibody

CAT#: TA332034

Rabbit Polyclonal Anti-RELB Antibody

Product Images

WB Suggested Anti-RELB Antibody Titration: 1.25ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RELB Antibody: synthetic peptide directed towards the C terminal of human RELB. Synthetic peptide located within the following region: GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: RELB proto-oncogene, NF-kB subunit
• Database Link:
  NP_006500
  Entrez Gene 19698 MouseEntrez Gene 5971 Human
  UniProt ID Q01201
• Background: RELB neither associates with DNA nor with RELA/p65 or REL. It stimulates promoter activity in the presence of NFKB2/p49.
• Synonyms: I-REL; IREL; REL-B
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 94%; Bovine: 94%; Dog: 88%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: MAPK signaling pathway