HDAC4 Rabbit Polyclonal Antibody

CAT#: TA332046

Rabbit Polyclonal Anti-Hdac4 Antibody

Product Images

WB Suggested Anti-Hdac4 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Liver

• 

  Lanes: Lane 1: 40ug mouse brain, synaptosome lysate; Lane 2: 40ug mouse brain, membrane fraction; Lane 3: 40ug mouse brain, cytoplasm fraction; Lane 4: 40ug mouse brain, nuclear fraction; Lane 5: 40ug mouse brain, post synaptic density fraction; Lane 6: 4

• 

  Chromatin Immunoprecipitation (ChIP) Using Hdac4 Antibody - C-terminal region and HCT116 Cells

Specifications

Product Data

• Applications: Assay, WB
• Recommended Dilution: WB, ChIP
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Hdac4 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac4. Synthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 118 kDa
• Gene Name: histone deacetylase 4
• Database Link:
  NP_006028
  Entrez Gene 208727 MouseEntrez Gene 9759 Human
  UniProt ID P56524
• Background: Hdac4 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D.
• Synonyms: AHO3; BDMR; HA6116; HD4; HDAC-4; HDAC-A; HDACA
• Note: Immunogen sequence homology: Dog: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Zebrafish: 93%; Guinea pig: 93%; Mouse: 86%; Yeast: 82%; Horse: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors