TEC Rabbit Polyclonal Antibody

CAT#: TA332105

Rabbit Polyclonal Anti-TEFM Antibody

Product Images

Host: Rabbit; Target Name: TEFM; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TEFM Antibody is: synthetic peptide directed towards the N-terminal region of Human TEFM. Synthetic peptide located within the following region: RSSLYWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENALDKLFSSEQQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: tec protein tyrosine kinase
• Database Link:
  NP_003206
  Entrez Gene 7006 Human
  UniProt ID P42680
• Background: TEFM is a transcription elongation factor which increases mitochondrial RNA polymerase processivity. It regulates transcription of the mitochondrial genome, including genes important for the oxidative phosphorylation machinery.
• Synonyms: PSCTK4
• Note: Immunogen sequence homology: Human: 100%; Pig: 79%; Dog: 77%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: T cell receptor signaling pathway