KDELR2 Rabbit Polyclonal Antibody

CAT#: TA332202

Rabbit Polyclonal Anti-KDELR2 Antibody

Product Images

Host: Rabbit; Target Name: KDELR2; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KDELR2 Antibody is: synthetic peptide directed towards the C-terminal region of Human KDELR2. Synthetic peptide located within the following region: ASVLQGARTEFLPQQRHKMLDTENQKLNSFVADSHQWLCKNAEEKSQKVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: KDEL endoplasmic reticulum protein retention receptor 2
• Database Link:
  NP_001094073
  Entrez Gene 11014 Human
  UniProt ID P33947
• Background: Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognizes, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the KDEL receptor gene family, have been described. KDELR2 was the second member of the family to be identified, and it encodes a protein which is 83% identical to the KDELR1 gene product.
• Synonyms: ELP-1; ERD2.2
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Vibrio cholerae infection