SPDYA Rabbit Polyclonal Antibody

CAT#: TA333382

Rabbit Polyclonal Anti-SPDYA Antibody

Product Images

WB Suggested Anti-SPDYA Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SPDYA Antibody: synthetic peptide directed towards the N terminal of human SPDYA. Synthetic peptide located within the following region: MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: speedy/RINGO cell cycle regulator family member A
• Database Link:
  NP_877433
  Entrez Gene 245711 Human
  UniProt ID Q5MJ70
• Background: SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.
• Synonyms: RINGO3; RINGOA; SPDY1; SPY1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 92%; Mouse: 85%; Rabbit: 85%

Reference Data

• Protein Pathways: Oocyte meiosis, Progesterone-mediated oocyte maturation