Germany
Japan
United Kingdom
China
Anti-SPDYA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Antibodies
View as table Download
Rabbit Polyclonal Speedy/Ringo Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Speedy/Ringo Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region of the human Speedy protein (within residues 200-286). This immunogen is conserved in both isoforms 1 and 2. [Swiss-Prot Q5MJ69] |
Rabbit Polyclonal Anti-SPDYA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPDYA Antibody: synthetic peptide directed towards the N terminal of human SPDYA. Synthetic peptide located within the following region: MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNT |
Rabbit Polyclonal Anti-SPDYA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPDYA Antibody: synthetic peptide directed towards the middle region of human SPDYA. Synthetic peptide located within the following region: HTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK |
SPDYA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-313 of human SPDYA (NP_877433.2). |
| Modifications | Unmodified |
SPDYA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-313 of human SPDYA (NP_877433.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SPDYA